- Recombinant Arabidopsis thaliana Putative RING-H2 finger protein ATL21B (ATL21B)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1197688
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 40,919 Da
- E Coli or Yeast
- 24-362
- Putative RING-H2 finger protein ATL21B (ATL21B)
Sequence
SNPSKCSSSNSRPHRCGPLEVPIRFPFCDHPLFNLLCTNLNNTVLQLPMSGTFFVQYIDYRKQQIYINDPENCLAKRLLTFNISGSPFSPRFDTLYTFLTCPNELVLPSWYPSIPCLSNSTSSFFATSNFALAESMLPSCQIVKRIYVPADSPFAETRFSSYLNQSLLLEWNSPNCRGCEIDYLRCGFKNKASPEVKCFGAKKSGHLSRAVVAVLICLSIIGAVILFVTCIAIRIHNTPRRRHWAVPAAAATVMQQPREVMATRGLDQSTIEKYKTMELGESRRPPGTNGIVCPICLSEYVSKETVRFIPECDHCFHAKCIDVWLKIHGSCPLCRNSRA